Buty

Sortuj według: Nowo dodane | od niższej ceny | od wyższej ceny

Buty Męskie Rozm. 43

45.00 zł - Toruń (Kujawsko-Pomorskie) - 17-01-2018

Sprzedam używane buty męskie rozm. 43. Niebieskie Wojas i brązowe są skórzane. Czarne cena 45 zł, niebieskie cena 80 zł, brązowe cena 80 zł. Tylko odbiór osobisty ⭕ 693596166

Szpilki, Czółenka Pomarańczowe

1.00 zł - Kraków (Małopolskie) - 17-01-2018

Sprzedam klasyczne, pomarańczowe szpilki z zamszu. Stan bardzo dobry, były użyte tylko kilka razy. Wysokość obcasa - ok.9 cm, rozmiar - 38, długość wkładki - ok. 25 cm. Możliwy odbiór własny lub wysyłka ( + 10zł) Polecam ! ⭕ 503905420

R. 44 Kozaki>Nowe NIKE< Zamsz+ SYSTEM AIR! /WYGODNE/ Na Chłodniejsze Dni

200.00 zł - Kraków (Małopolskie) - 17-01-2018

Na sprzedaż mam sportowo eleganckie kozaki rozmiar 44 - WKŁADKA 28 CM firmy NIKE.BUTY NIKE NA CHŁODNIEJSZE DNI ! wyższe / jak trekkingowe / jesienne / trapery bardzo wygodne , solidnie wykonane buty męskie ze skóry zamszowej (bardzo podobne do tych topowych modeli firmy Timberland -a ). Nike max tra...

Gino Rossi Venezia Wojas 40 Skóra

150.00 zł - Kłodzko (dolnoslaskie) - 17-01-2018

Sprzedam buty z skóry naturalnej marki Wojas, Venezia, Gino Rossi,Mohito. Rozmiar 40.Całość lub pojedynczo .Podana cena jest ceną za 6 par.Możliwość wysyłki wg cennika przewoźnika. ⭕ 601453646

Buty Myśliwskie Militarne Taktyczne Roz 44 Wojskowe

145.00 zł - Łódź (Wielkopolskie) - 17-01-2018

Buty Myśliwskie - Militarne. Rozmiar 44 - Wkładka 28.5 cm Specyfikacja Techniczna: - Wykonanie: Skóra - Podeszwa: VIBRAM - Materiay: Gore-Tex - Dwie wkładki w bucie: SORBOTHANE i STILFLEX Buty solidnie wykonane, z najlepszymi technologiami dostępnymi na rynku. Zobacz inne moje ogłoszenia...Kolorczar...

Balerinki Bezowe

10.00 zł - Poznań (Wielkopolskie) - 17-01-2018

sprzedam balerinki bezowe nakrapiane zlotymi ciekinkami rozmiar38 bardzo ladne.kontakt tylko przez lub sms ⭕ 696812927

Nowe Buty Ecco Cool Walk Tanio!!!

350.00 zł - Warszawa (Mazowieckie) - 17-01-2018

Witam mam do zaoferowania nowe buty Duńskiej firmy Ecco nazwa modelu Cool Walk buty posiadają Gore tex rozmiar 42 cena do negocjacji zapraszam do kontaktu ;) Ps; cena w sklepie 749zl ⭕ 721629176

Kozaczki Wysokie Zamszowe Siwe Leilida

40.00 zł - Olesno (Małopolskie) - 17-01-2018

Nie wszystkie rzeczy jeszcze wystawiłem. Zobacz na mojej stronie, wpisz: wielkiniesmiertelny.simplesite - tam znajdziesz pełniejszą moją ofertę. Kliknij na: Album zdjęciowy, później: Odtwarzaj. Możesz dać pełny ekran w dolnym prawym rogu. Mam do sprzedania kozaczki wysokie zamszowe koloru siwego fir...

Ładne Botki Ocieplane.

99.00 zł - Warszawa (Mazowieckie) - 17-01-2018

Sprzedam botki-kalosze ocieplane,czarne,nr.41, zagraniczne.Botki nadają się na stopę z niskim podbiciem. Buty są nowe,ale przymierzone. ⭕ 536114278

Buty Sportowe PUMA, Rozm. 36, Białe

15.00 zł - Włochy (Świętokrzyskie) - 17-01-2018

ZAPROPONUJ CENĘ do sprzedania buty sportowe PUMA, białe, używane, rozmiar 36 polecam do odbioru Warszawa Włochy ⭕ 798200999

NOWE Adidas Adipure 360 3M R. 46.5/ 47 Wkładka 31 /30.5 Cm <<

150.00 zł - Kraków (Małopolskie) - 17-01-2018

Na sprzedaż mam buty Adidas model Adipure 360 3M Rozmiar to wkładka 29 / 29,5 cm tak podaje producent , r. 45.5 / 45 mam też większe 46.5 / 47 31 cm tak podaje producent (mysle ,ze tez dobre na kogos co ma 30.5 cm ) Niezwykle Lekkie , sOLIDNIE WYKONANE , KOMFORTOWE BUTY , IDEALNE DO BIEGANIA ALE I N...

Adidas Crazy Train Rpu Pro 41 1/3

220.00 zł - Wola (Podkarpackie) - 17-01-2018

Buty nowe przywiezione ze Stanów. Rozmiar okazał się nietrafiony. Buty oryginalne, brak pudełka i metek. W Polsce rzadko spotykany model :) ⭕ 538804809

Niskie, Morskie Czółenka

40.00 zł - Kraków (Małopolskie) - 17-01-2018

Sprzedam niskie, klasyczne czółenka w morskim kolorze firmy Jenny Fairy (CCC). Stan bardzo dobry, były użyte tylko kilka razy. Wysokość obcasa - ok.7 cm, rozmiar - 38, długość wkładki - ok. 25 cm. Możliwy odbiór własny lub wysyłka ( + 10zł) Polecam ! ⭕ 666633983

Buty Trekkingowe Sportowe Górskie 41 SALOMON

120.00 zł - Łódź (Wielkopolskie) - 17-01-2018

Buty Trekkingowe SALOMON Rozmiar 41 - Wkładka 26 cm Technologia - Gore-Tex - contagrip Buty w stanie Bdb. Zobacz inne moje ogłoszenia...Kolorszary/srebrny ⭕ 511663740

Buty 45 Trekkingowe Sportowe Górskie GRONELL

165.00 zł - Łódź (Wielkopolskie) - 17-01-2018

Buty trekkingowe renomowanej włoskiej marki GRONELLRozmiar 45 - Wkładka 28.5 cm - Skóra naturalna . buty mimo to są leciutkie i bardzo wygodne. - Wodoodporne ale oddychające dzięki technologii SYMPATEX - Podeszwa o technologii TRAIL Stan butów bardzo dobry. Zobacz inne moje ogłoszenia...Kolorbrązowy...

BUTY Firmy SOLOGNAC NOWE Rozm. 46

79.00 zł - Warszawa (Mazowieckie) - 17-01-2018

Buty myśliwskie firmy SOLOGNAC model NAMIB 200 w kolorze zielonym (khaki), rozmiar 46 (29,5cm) lekkie i bardzo wytrzymałe, idealne na długie wędrówki w różnym terenie. Nowe. Odbiór w Centrum. ⭕ 514091504

Sprzedam Czarne Szpilki

40.00 zł - Łódź (Wielkopolskie) - 17-01-2018

Witam.sprzedam raz używane czarne szpilki w dobrym stanie rozm 40 a obcas 11 cm.Ptosze o tel do godziny 19 bez SMS i zastrzeżonych. ⭕ 793425795

Buty Gino Lanetti

70.00 zł - Warszawa (Mazowieckie) - 17-01-2018

Hit 2018 roku Nie marnuj czasu Kupuj teraz Buty Gino Lanetti Napisano 44 rozmiar Ale wydaje mi się ze może pasować na 42-43 W razie pytań 533 209 067 Zadzwoń a się dogadamy ⭕ 511842965

Super Okazja

250.00 zł - Warszawa (Mazowieckie) - 17-01-2018

Witam Sprzedam nowe buty nike air max (42,5) . cena w sklepie to ponad 300 zl !!! Więcej info pod nr tel 532 175 832 Pozdrawiam ⭕ 577762238

Buty Botki Kozaki Szpilki Rozmiar 38 Różne Rodzaje Obuwia Od 22zł

22.00 zł - Kraków (Małopolskie) - 17-01-2018

Do sprzedania różne typy obuwia NOWE Szpilki buty na lato, kozaki, botki różne rodzaje na wiosnę i lato Rozmiar głównie 38 Cena od 24zł do negocjacji :) SPRZEDAM kozaki: 38 - 95złbotki koturny: 38 - 29zł botki bez futerka: 37 - 29zł botki z futerkiem: 38 - 29złpanterka rozmiar 37- 24zł koturny beż r...

Ostatnia Szansa Po Sezonie! Przepiękne Włoskie Skórzane Japonki Z Frędzlami, R. 40, BP ZONE, NOWE!

33.00 zł - Warszawa (Mazowieckie) - 17-01-2018

Jak w tytule - klapki japonki z prawdziwego zamszu, podeszwa cała ze skóry naturalnej dł. 26,3 cm, matowa wyściółka z nubuku eliminuje odparzenia i ślizganie się stopy, dopracowanie w szczegółach, klasa! Made in Italy. Cena do drobnej negocjacji. Odbiór osobisty Warszawa z przymiarką, płatność gotów...

Buty Trekkingowe Sportowe Górskie 36 LA SPORTIVA

135.00 zł - Łódź (Wielkopolskie) - 17-01-2018

Buty Trekkingowe Marka: LA SPORTIVA Rozmiar 36 - Wkładka 23 cm Specyfikacja Techniczna: - Membrana: Gore-Tex® - Podeszwa: Vibram® Lite Run Stan: Buty w DB kondycji. Zobacz inne moje ogłoszenia...Kolorbrązowy/beżowy ⭕ 531651680

Buty Ocieplane Skechers

100.00 zł - Strzelno (pomorskie) - 17-01-2018

Brązowy zamsz ocieplane białym futerkiem stan bardzo dobry mało używane ⭕ 532579307

Czarne Eleganckie Pantofle - Półbuty - R.44 - Nowe

25.00 zł - Ostrołęka (Mazowieckie) - 17-01-2018

Sprzedam: Męskie Buty - eleganckie Pantofle - Półbuty . Cena : 25zł Czarne Buty ze skóro podobnego materiału. Buty są sznurowane. Nowe Rozmiar :44 Długość wkładki wewnętrznej :29cm Od środka obszyte skórą naturalną. Możliwa wysyłka . W razie pytań proszę pisać. Polecam:) ⭕ 668008076

Sprzedam Buty Zimowe Po Nartach

185.00 zł - Wrocław (Dolnośląskie) - 17-01-2018

Sprzedam buty zimowe damskie, po nartach.Buty apres ski, kolor czarny, bardzo lekkie, ciepłe.Rozmiar: 37 / moze być 37.5 /. ⭕ 516536675

Buty Hit Sezonu 2018

180.00 zł - Warszawa (Mazowieckie) - 17-01-2018

Mega buty Brand „Osiris” Materiał: tekstylny/płócienny • Wzmocnione strefy narażone na uszkodzenie • Wyściełane gąbką kołnierz i język • Wulkanizowana podeszwa Wkładka EVA • Podeszwa z tworzywa sztucznego W zestawie zmienne sznurówki W razie pytań proszę o kontakt 533 209 067 Warszawa Polecam ⭕ 7952...

Buty ADIDAS Superstar KAISER Of NY BECKENBAUER Rozm.46 I 2/3

55.00 zł - Warszawa (Mazowieckie) - 17-01-2018

Buty ADIDAS Superstar KAISER of NY BECKENBAUER Do gry w koszykówkę i codziennego użytkowania Rozmiar 46 i 2/3 Wkładka 30cm Bardzo trudno dostępne w Polsce Naturalne ślady użytkowania Kolor czarny Opis producenta: Dwie legendy spotykają się w jednym miejscu. Chodzi tu oczywiście o Superstara i gwiazd...

Buty NIKE TOTAL 90 III / Rozm. 44 / Nowe

55.00 zł - Warszawa (Mazowieckie) - 17-01-2018

Buty NIKE TOTAL 90 III Do gry na hali lub codziennego użytkowania Rozmiar 44 Buty są prezentem. Założone 1 raz i są za duże (mam 42,5) Wysyłka: 5zł lub odbiór osobisty W-wa Pozdrawiam ⭕ 604974611

140 Par Buty Damskie

5500.00 zł - Kłodzko (Dolnośląskie) - 17-01-2018

witam na sprzedaz 140 par buty nowe w pudelkach odbior osobisty w klodzku lub kurier buty wysylane sa z uk wysylka od 3-5 dni platnosc paypal w razie pytan prosze sie kontaktowac ⭕ 887371492

Sprzedam Buty Zimowe Męskie Gino Rossi Rozm 44-45

55.00 zł - Kraków (Małopolskie) - 17-01-2018

Sprzedam buty męskie, zimowe, ocieplane, skórzane w kolorze czarnym. Buty zapinane na suwak używane w dobrym stanie. Rozmiar 44-45. Polecam. ⭕ 783898282

Buty Trekkingowe Sportowe Górskie GRISPORT Roz 38

120.00 zł - Łódź (Wielkopolskie) - 17-01-2018

Buty Trekkingi marki GRIsport OUTDOR to wear ADVENTURE Rozmiar 38 - Wkładka 24 cm Technologie Buta: - Support system - GRITEX - ROCK outdoor - rubbermac ®Kolorczarnybrązowy/beżowy ⭕ 739469468

Buty Trekkingowe Sportowe Górskie ECCO Roz 38

130.00 zł - Łódź (Wielkopolskie) - 17-01-2018

Buty Trekkingi marki ECCORozmiar 38 - Wkładka 25 cm Technologie w Bucie: - Gore-Tex - YAK - EPR 40 - receptor technology Buty w db stanie. Zobacz inne moje ogłoszenia...Kolorbrązowy/beżowy ⭕ 798408021

Kozqaczki Niskie Skórzane Czarne Clara Barson

40.00 zł - Olesno (Małopolskie) - 17-01-2018

Nie wszystkie rzeczy jeszcze wystawiłem. Zobacz na mojej stronie, wpisz: wielkiniesmiertelny.simplesite - tam znajdziesz pełniejszą moją ofertę. Kliknij na: Album zdjęciowy, później: Odtwarzaj. Możesz dać pełny ekran w dolnym prawym rogu. Mam do sprzedania kozaczki niskie koloru czarnego ze skóry. R...

Sprzedam Kozaki Damskie, Skórzane Caprice Rozmiar 37

50.00 zł - Kraków (Małopolskie) - 17-01-2018

Mam do sprzedania kozaki damskie, skórzane, ocieplane, renomowanej firmy Caprice. Buty są w kolorze jasnego brązu. Posiadają membranę. Długość cholewki 27,5 cm, zapinane na suwak. Szerokość cholewki u dołu w kostce w obwodzie 25 cm u góry w łydce obwód wynosi 33 cm. Wysokość obcasa 5 cm. Rozmiar 37 ...

Buty Wojskowe Desant Armex Rozmiar 27.5cm,nowe,skórzane,okazja

120.00 zł - Kraków (Małopolskie) - 17-01-2018

sprzedam nowe buty wojskowe desant, armex, rozmiar 27.5, skórzane, ⭕ 663587969

Buty Taktyczne Lowa Rozmiar 42

499.00 zł - Kraków (Małopolskie) - 17-01-2018

Witam, Mam do sprzedania nowiutkie buty taktyczne firmy Lowa Desert Z-65 GTX rozmiar: EU 42, UK 8, US 9 - dł. wkładki 27,5 cm. Buty nigdy nie były używane. Możliwość negocjacji. Kontakt: 602 11 43 87 ⭕ 669768890

Czółenka Czarne TARYN ROSE

120.00 zł - Łódź (Wielkopolskie) - 17-01-2018

Czarne zamszowe czółenka wykończone skórą (na zewnątrz i wewnątrz). Bardzo lekkie, delikatne ze skrzyżowanymi paskami z gumy. Podeszwa ze skóry. Eleganckie i zgrabne, na każdą okazję. Super fason i firma. Przywiezione ze Stanów. Stan bardzo dobry.37rozm ⭕ 693930657

Sprzedam Buty NIKE GORETEX ALL-TRAC-damskie Nowe

110.00 zł - Kraków (Małopolskie) - 17-01-2018

Sprzedam buty damskie zimowe Rozmiar 40 długość wkładki 26 cm Buty są jak nowe Nie odpowiadam na SMS i e-mail Więcej foto mogę wysłać Buty nie przepuszczają wody cena do lekkiej negocjacji dwa razy ubrane ⭕ 539005505

Kozaczki Niskie Materiał Ozdobny Barbie Dla Dziewczyny

45.00 zł - Olesno (Małopolskie) - 17-01-2018

Nie wszystkie rzeczy jeszcze wystawiłem. Zobacz na mojej stronie, wpisz: wielkiniesmiertelny.simplesite - tam znajdziesz pełniejszą moją ofertę. Kliknij na: Album zdjęciowy, później: Odtwarzaj. Możesz dać pełny ekran w dolnym prawym rogu. Mam do sprzedania bardzo ładne kozaczki dla dziewczyny z mate...

Mokasyny Vintage

39.00 zł - Warszawa (Mazowieckie) - 16-01-2018

Mokasyny vintage bordowo brazowe rozmiar 39, lekkie dwa male starcia na jednym bucie od wewnetrznej str. Poza tym stan idealny. ⭕ 739108286

Sprzedam Botki Damskie VICES Nowe

50.00 zł - Kraków (Małopolskie) - 16-01-2018

Sprzedam Nowe Botki Firmy VICES rozmiar 40 wkładka 26 cm nie odpowiadam na email,sms serdecznie polecam ⭕ 736650408

Sprzedam Buty Baletki Typu Melissa Crocs Rozmiar 37

29.00 zł - Kraków (Małopolskie) - 16-01-2018

Sprzedam buty damskie baletki gumowe przeźroczyste, typu Melissa, Crocs w rozmiarze 37. Buty są w idealnym stanie. Nadają się do wody, na plażę oraz do chodzenia na co dzień. Polecam. ⭕ 508465232

Nowe Szpilki T.Taccardi Rozmiar 40

90.00 zł - Łódź (Wielkopolskie) - 16-01-2018

Sprzedam szpilki firmy T.Taccardi zakupione w sklepie Kari. Szpilki są nowe, w oryginalnym opakowaniu. Kolor :nude, delikatny wzór widoczny na zdjęciach. Rozmiar 40, długość wkładki 26 cm, wysokość obcasa 11cm. Zakupione za 119 zł, sprzedam za 90zł. ⭕ 667252578

Buty Trekkingowe Miejskie Sportowe 42 ROCKPORT

125.00 zł - Łódź (Wielkopolskie) - 16-01-2018

Buty Trekkingi - Miejskie Marka ROCKPORT Rozmiar 42 - Wkładka 27 cm Technologie: - Gore-Tex (wodoodporne oddychające) - podeszwa VIBRAM Buty w BDB stanie. Zobacz inne moje ogłoszenia...Kolorbrązowy/beżowy ⭕ 662082681

Nowe Buty Sneakersy 39-40

1.00 zł - Kraków (Małopolskie) - 16-01-2018

Witam. Oddam nowe buty czarne sneakersy rozmiar 39/40 z pudełkiem. Na pampersy dla dziecka firmy Pampers 2 3-6kg około 80sztuk. Odbiór osobisty. ⭕ 691209013

Nowe ! Adidas Lite Runner Jak Nike Rosherun ! ROZM. 41, 42.5 , 45, 46/47 , MEGA LEKKIE I WYGODNE

140.00 zł - Kraków (Małopolskie) - 16-01-2018

Sprzedam NOWE Adidas Lite Runner rozmiar 41 ( 26 cm ) , 42.5 ( 27 CM )45 ( 29 cm ) , 46/ 47 (30,5 cm - tak podaje producent , myśle ,że śmiało na kogoś co ma 30 cm )PODAŁEM ROZMIARÓWKĘ JAKĄ PODAJE ADIDAS , DLA KOMFORTU POLECAM PORÓWNAĆ Z INNYMI BUTAMI ADIDASA I NIE KUPOWAC NA STYK , NP JAK MASZ STOP...

Buty Adidas Performance

200.00 zł - Wesoła (Mazowieckie) - 16-01-2018

Sprzedam nowe, nieużywane buty męskie żwirówki adidas performance rozmiar 46 ⭕ 601601973

Sprzedam Dwie Pary Botów Dla Dziecka

120.00 zł - Wrocław (Dolnośląskie) - 16-01-2018

Sprzedam dwie pary botów dla dziecka jedne korki w super stanie raz na nogach rozm 28,5 ⭕ 572975001

Nike Air Jordan SC-3 Premium Black Cement

250.00 zł - Wrocław (Dolnośląskie) - 16-01-2018

Buty legendarnej już marki Michaela Jordana znanej na całym świecie z systemem powietrznym Air w podeszwach buta ORYGINALNE RZADKIE do chodzenia na co dzień jak i do koszykówki w bardzo pożądanym kolorze jak i rozmiarze 43EUR (9.5US) ⭕ 516021886

Sprzedam Buty NIKE GORETEX ALL-TRAC-damskie Nowe

110.00 zł - Kraków (Małopolskie) - 16-01-2018

Sprzedam buty damskie zimowe Rozmiar 40 długość wkładki 26 cm Buty są jak nowe Nie odpowiadam na SMS i e-mail Więcej foto mogę wysłać Buty nie przepuszczają wody cena do lekkiej negocjacji dwa razy ubrane ⭕ 724162530